Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bepB_

Fold library idPDB HeaderMoleculeTitle
c4bepB_PDB header: transferaseChain: B: PDB Molecule: phosphocholine transferase ankx;PDBTitle: crystal structure of the legionella pneumophila fic domain-2 containing effector ankx protein (apo-form)


Added to library: Sat Apr 27 08:36:40 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SS
TS
GGGGGGGTS
TTTTTTSTT
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence DLIKRIHKKCGKPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS






SS


GGGB

TT




SSS


S

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLNPEQIPDLAKQIYFDXCKYGHSNTNHFYLAVXKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

GGG
TT



S


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence XYEVLHPFRDANGRTFVNNLLNIPLXQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S

SSS
TTTTTTT





SS
TTTTBS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence TPITLYGYHSSLEEQTKFRDXLDSPSYEKIKHXDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



STT






T


TTS
TTSTTSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence GEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNXAXLDELIAKKADLSLQDYDGKTALHYAA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT

T

B
TTS
GGGBT

T
TT

TT


TTS

 .........430.........440.........450.........460....
Sequence ECGNXQIXGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGT
Predicted secondary structure






















SS confidence











































Known secondary structure (DSSP) T
TSTTT


TTS

TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D