Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3r27A_

Fold library idPDB HeaderMoleculeTitle
c3r27A_PDB header: protein bindingChain: A: PDB Molecule: heterogeneous nuclear ribonucleoprotein l;PDBTitle: crystal structure of the first rrm domain of heterogeneous nuclear2 ribonucleoprotein l (hnrnp l)


Added to library: Sat Sep 17 09:58:58 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




SS

TT

GGGS
TTTTSSS
TT
 .........80....
Sequence HPAFVNYSTSQKIS
Predicted secondary structure






SS confidence













Known secondary structure (DSSP)
S
S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D