Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3izcS_

Fold library idPDB HeaderMoleculeTitle
c3izcS_PDB header: ribosomeChain: S: PDB Molecule: 60s ribosomal protein rpl20 (l18ae);PDBTitle: localization of the large subunit ribosomal proteins into a 6.1 a2 cryo-em map of saccharomyces cerevisiae translating 80s ribosome


Added to library: Sat Dec 11 16:10:38 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
S





SSS




SSTT


SSS





SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS




SSS


SBTTT

SS





TTT

S
 .........150.........160.......
Sequence TKQFHKSDIKFPLVYRKVRPPTRKLKT
Predicted secondary structure
















SS confidence


























Known secondary structure (DSSP) TSSSSTTT

TTTTS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D