Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3a56B_

Fold library idPDB HeaderMoleculeTitle
c3a56B_PDB header: hydrolaseChain: B: PDB Molecule: protein-glutaminase;PDBTitle: crystal structure of pro- protein-glutaminase


Added to library: Sat Aug 28 22:00:25 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKLKDFGKTVPVGIDEENGMIKVSFMLTAQFYEIKPTKENEQYIGMLRQAVKNESPVHIFLKPNSNEIGK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



TTSS





TTTT


TTSSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence VESASPEDVRYFKTILTKEVKGQTNKLASVIPDVATLNSLFNQIKNQSCGTSTASSPCITFRYPVDGCYA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


SBS





S

BSS
TTBTTSSS

SS
B
TT
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RAHKMRQILMNNGYDCEKQFVYGNLKASTGTCCVAWSYHVAILVSYKNASGVTEKRIIDPSLFSSGPVTD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTB


SS

TTS

TTT
SSS
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence TAWRNACVNTSCGSASVSSYANTAGNVYYRSPSNSYLYDNNLINTNCVLTKFSLLSGCSPSPAPDVSSCG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TB
GGGS

TT
TTS

GGGTTT
BTTBSSS



TT

 .
Sequence F
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D