Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2xotA_

Fold library idPDB HeaderMoleculeTitle
c2xotA_PDB header: cell adhesionChain: A: PDB Molecule: amphoterin-induced protein 1;PDBTitle: crystal structure of neuronal leucine rich repeat protein amigo-1


Added to library: Sat Sep 24 10:58:27 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


TT

TT
TT

SS

SS

SS

TT
S

SS



TTSSSS

TT



SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence NFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQN
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)

TTTTTT
TT



SS



TTTTTT
TT



SS



TTTTTT
TT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QISRFPVELIKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLS
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


S

GGGT

TT



SS





S
TT

SS


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQ
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TTGGG
SSS

GGG


TT

S





TT





SSTT

TTS
B

S
 .........290.........300.........310.........320.........330.
Sequence GSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLH
Predicted secondary structure














SS confidence


















































Known secondary structure (DSSP)
SSSSTTSS

TTS

SS
SS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D