Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2lqnA_

Fold library idPDB HeaderMoleculeTitle
c2lqnA_PDB header: signaling proteinChain: A: PDB Molecule: crk-like protein;PDBTitle: solution structure of crkl


Added to library: Sat May 19 11:50:24 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

S

S
SS
S
SSSTTSS
SSSTT
STT

TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TTSSTTTT
SSSS




SS



SS



SS
SSSSSSSSSS
B


SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) B

B
SS

SSS
SS

GGGSS




SSTT



SS




GGGTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)










S




S


S





S
B


TT
SSB

B
TT

TTS
S
 .........290.........300...
Sequence GRKGLFPFTHVKIFDPQNPDENE
Predicted secondary structure












SS confidence






















Known secondary structure (DSSP) S

TT
SSSSTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D