Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2l8sA_

Fold library idPDB HeaderMoleculeTitle
c2l8sA_PDB header: cell adhesionChain: A: PDB Molecule: integrin alpha-1;PDBTitle: solution nmr structure of transmembrane and cytosolic regions of2 integrin alpha1 in detergent micelles


Added to library: Sat Feb 4 17:43:54 2012
 
Links to external resources


 1........10.........20.........30.........40......
Sequence MGLPGRVPLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Predicted secondary structure








SS confidence













































Known secondary structure (DSSP)







TTTS

S





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D