Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2hjnA_

Fold library idPDB HeaderMoleculeTitle
c2hjnA_PDB header: cell cycleChain: A: PDB Molecule: maintenance of ploidy protein mob1;PDBTitle: structural and functional analysis of saccharomyces2 cerevisiae mob1


Added to library: Tue Mar 16 12:58:15 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PVLTTNVTDFNYTPSHQKPFLDIKQIVEXTLGSEGVAVKLPRGEDENEWLAVHCVDFYNQINXLYGSITE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)




TTS










GGG


S

TT

GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence FCSPQTCPRXIATNEYEYLWAFQKGQPPVSVSAPKYVECLXRWCQDQFDDESLFPSKVTGTFPEGFIQRV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) G

TTT
SS
BSSTT
B
SSTTS

B


T
TTTS
SSTT



TTT
 .........150.........160.........170.........180.........190.........200......
Sequence IQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPADFGPLLELVXELRD
Predicted secondary structure










SS confidence

































































Known secondary structure (DSSP) STT
TT
S
GGGGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D