Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2dx1A_

Fold library idPDB HeaderMoleculeTitle
c2dx1A_PDB header: signaling proteinChain: A: PDB Molecule: rho guanine nucleotide exchange factor 4;PDBTitle: crystal structure of rhogef protein asef


Added to library: Tue Mar 16 14:00:33 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LAINELISDGSVVCAEALWDHVTXDDQELGFKAGDVIEVXDATNREWWWGRVADGEGWFPASFVRLRVNQ
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TT

SS
B



TTB

B
TT


SSS
SS
GGG
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence DAQSSKDQXRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADXFSEEQLRTIFGNIEDIYRCQKAFVK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)


TTT
TTT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ALEQRFNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKXIDIS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

SSSGGG


TTT
T

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence LDGFLLTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAXKNVAQLINERKRRLENIDKIAQWQSSI
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) TS
TT
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence EDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRXFFLFDHQLIYCKKDLLRRDVLYYKGRLDXDGLEVV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) BS

SS




SSSS
TT
TT
TT
TTT

 .........360.........370.........380.....
Sequence IKNAFRLHSHLLCTRKPEQKQRWLKAFAREREQVQ
Predicted secondary structure




SS confidence


































Known secondary structure (DSSP)




S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D