Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2bbdA_

Fold library idPDB HeaderMoleculeTitle
c2bbdA_PDB header: viral proteinChain: A: PDB Molecule: coat protein;PDBTitle: crystal structure of the stiv mcp


Added to library: Tue Mar 16 14:26:13 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GEIYTETLQQTYAWTAGTNIPIKIPRNNFIRKIRVQLIGSISNSGTAAVTLPSAPFPYNLVQTFNLSYEG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S



SS


SS
SSS



TTTTGGGTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SKTLYSVSGTGLGILXYYTTKGQNPAYPAPGTSVPASGSVNLNVXWEFDLARFPATXVQNIILSILTGQA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTTT
S
S
TT

TT
GGGSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence PSGVSINASFYITITYERVTAQEILSEGGLGADGEXPLATVLPKVIEIPTFNVPASSAPIHVAYLQPGQI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
TT


TT
B
TTSSSBTT




SS


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence YKRQLVYVINSTSGINNTDPTEYELKIVRGVPTDKIKVSWAALQAENQAEYQVAPYSGASAIIDFRKYFN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) BTTTBTS



SSS
SS

SSTTGGGTTT
 .........290.........300.........310.........320...
Sequence GDLDLTHAPSDSIEYDLALQNQDNVYSLYVSYVLPYYDQLAAL
Predicted secondary structure













SS confidence










































Known secondary structure (DSSP) SS
TT

TT
SS

TTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D