Return to main results Retrieve Phyre Job Id

Job DescriptionP09394
Confidence28.22%DateThu Jan 5 11:02:21 GMT 2012
Rank129Aligned Residues37
% Identity24%Templatec3c52B_
PDB info PDB header:lyaseChain: B: PDB Molecule:fructose-bisphosphate aldolase; PDBTitle: class ii fructose-1,6-bisphosphate aldolase from2 helicobacter pylori in complex with3 phosphoglycolohydroxamic acid, a competitive inhibitor
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   296...300.........310.........320.........330......... 340.........350.......
Predicted Secondary structure 











.





Query SS confidence 











































.

















Query Sequence  LTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAG. VNGLFTDFPDKAVKFLNK
Query Conservation      
  
   

 
  



                  
   
.






 
      
  
Alig confidence 
















........................


.






.









Template Conservation 
  

  

  

 


........................


 


  
 .



  

  
Template Sequence  TSKVVKMAHNAGVSVEA. . . . . . . . . . . . . . . . . . . . . . . . ELGRLMGILVN. PKEAEQFVKE
Template Known Secondary structure  TT
........................S







.
Template Predicted Secondary structure 


........................






.
Template SS confidence 






























































   117..120.........130... ......140.... .....150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions