Return to main results Retrieve Phyre Job Id

Job DescriptionP09394
Confidence70.85%DateThu Jan 5 11:02:21 GMT 2012
Rank57Aligned Residues35
% Identity26%Templatec2p10D_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:mll9387 protein; PDBTitle: crystal structure of a putative phosphonopyruvate hydrolase (mll9387)2 from mesorhizobium loti maff303099 at 2.15 a resolution
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   298.300.........310.........320.........330.........340....
Predicted Secondary structure 












Query SS confidence 














































Query Sequence  GMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLF
Query Conservation    
  
   

 
  



                  
   





Alig confidence 
























............









Template Conservation 



 

   







  


  ............
 







Template Sequence  EXIAEAHKLDLLTTPYVFSPEDAVA. . . . . . . . . . . . XAKAGADILV
Template Known Secondary structure  TT



S............T
S
Template Predicted Secondary structure 




............



Template SS confidence 














































   153......160.........170....... ..180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions