Return to main results Retrieve Phyre Job Id

Job DescriptionP75764
Confidence37.98%DateThu Jan 5 12:13:53 GMT 2012
Rank22Aligned Residues27
% Identity19%Templatec3l4gI_
PDB info PDB header:ligaseChain: I: PDB Molecule:phenylalanyl-trna synthetase alpha chain; PDBTitle: crystal structure of homo sapiens cytoplasmic phenylalanyl-trna2 synthetase
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   126...130.........140.........150.........160.....
Predicted Secondary structure 






















Query SS confidence 







































Query Sequence  HIAVIHQYMREMMAGGGKMILGSDSHTRYGALGTMAVGEG
Query Conservation 
 

 


 

  
 

  








 



 

 


Alig confidence 

















.............








Template Conservation 
 
   



   

   .............  
 




Template Sequence  NSGVFRPEMLLPMGLPEN. . . . . . . . . . . . . VSVIAWGLS
Template Known Secondary structure 


GGGT

TT.............
Template Predicted Secondary structure 











.............



Template SS confidence 







































   434.....440.........450. ........460
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions