Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAR8
Confidence74.95%DateThu Jan 5 11:13:37 GMT 2012
Rank96Aligned Residues26
% Identity42%Templated1b43a1
SCOP infoSAM domain-like 5' to 3' exonuclease, C-terminal subdomain 5' to 3' exonuclease, C-terminal subdomain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80.........90.........100.......
Predicted Secondary structure 












Query SS confidence 































Query Sequence  MNGVGLKKAQAIVSYREEYGPFKTVEDLKQVP
Query Conservation 
 


   
  

 

   
 
   
 
  
 
Alig confidence 













......











Template Conservation 
 


 


 


 ......    

      
Template Sequence  IKGIGLKKALEIVR. . . . . . HSKDPLAKFQKQ
Template Known Secondary structure  STT

......T
SSGGGGTGGG
Template Predicted Secondary structure 




......



Template SS confidence 































   241........250.... .....260......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions