Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAR8
Confidence72.45%DateThu Jan 5 11:13:37 GMT 2012
Rank104Aligned Residues24
% Identity25%Templatec3q8lA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:flap endonuclease 1; PDBTitle: crystal structure of human flap endonuclease fen1 (wt) in complex with2 substrate 5'-flap dna, sm3+, and k+
Resolution2.32 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80.........90.........100.....
Predicted Secondary structure 










Query SS confidence 





























Query Sequence  MNGVGLKKAQAIVSYREEYGPFKTVEDLKQ
Query Conservation 
 


   
  

 

   
 
   
 
  
Alig confidence 













......









Template Conservation 
 


 
 
  

 ......   
 
 
  
Template Sequence  IRGIGPKRAVDLIQ. . . . . . KHKSIEEIVR
Template Known Secondary structure 
TT

......
S
Template Predicted Secondary structure 




......

Template SS confidence 





























   238.240.........250. ........260.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions