Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGL2
Confidence15.50%DateThu Jan 5 11:29:25 GMT 2012
Rank35Aligned Residues24
% Identity29%Templatec3fqmA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:non-structural protein 5a; PDBTitle: crystal structure of a novel dimeric form of hcv ns5a domain i protein
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20. ........30....
Predicted Secondary structure 








............



Query SS confidence 










. . . . . . . . . . . .












Query Sequence  PGAIGPYVQGV. . . . . . . . . . . . DLGSMVFTSGQIP
Query Conservation 
     

 

............  
  
 



  
Alig confidence 










............












Template Conservation 
 



   

  
   



  
 

  



 
 
Template Sequence  PSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTT
Template Known Secondary structure 

S

STTTTSS
Template Predicted Secondary structure 












Template SS confidence 



































   100.........110.........120.........130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions