Return to main results Retrieve Phyre Job Id

Job DescriptionP76542
Confidence5.69%DateThu Jan 5 12:24:15 GMT 2012
Rank85Aligned Residues29
% Identity24%Templatec2rrhA_
PDB info PDB header:hormoneChain: A: PDB Molecule:vip peptides; PDBTitle: nmr structure of vasoactive intestinal peptide in methanol
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   359360.........370.........380.........390....
Predicted Secondary structure 




Query SS confidence 



































Query Sequence  HVPKGIRGVYNQAAYLKQRRAMMQDYADAIDSILAG
Query Conservation 
     
  
        

         
      
Alig confidence 












....





...









Template Conservation 







 


 ....




 ...



 


 
Template Sequence  HSDAVFTDNYTRL. . . . RKQMAV. . . KKYLNSILNG
Template Known Secondary structure 

T.......
Template Predicted Secondary structure 






.......

Template SS confidence 



































   1........10... ...... 20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions