Return to main results Retrieve Phyre Job Id

Job DescriptionP63020
Confidence14.57%DateWed Jan 25 15:20:59 GMT 2012
Rank47Aligned Residues28
% Identity21%Templatec2kt2A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:mercuric reductase; PDBTitle: structure of nmera, the n-terminal hma domain of tn501 mercuric2 reductase
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   143.... ..150.........160.........170........
Predicted Secondary structure 

.










Query SS confidence 




.






























Query Sequence  LQFGG. GCNGCSMVDVTLKEGIEKQLLNEFPELKGVR
Query Conservation 
 
 
. 
 

  
  

   

  
    


  
 
Alig confidence 




.





.......








.







Template Conservation 
 
 

 
  

.......  
   
  .  

  
 
Template Sequence  LKITGMTCDSCA. . . . . . . AHVKEALEK. VPGVQSAL
Template Known Secondary structure  SS
ST........STT
Template Predicted Secondary structure 



........


Template SS confidence 




































   4.....10..... ....20.... .....30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions