Return to main results Retrieve Phyre Job Id

Job DescriptionP52129
Confidence32.90%DateThu Jan 5 12:05:34 GMT 2012
Rank7Aligned Residues25
% Identity32%Templated2ix0a3
SCOP infoOB-fold Nucleic acid-binding proteins Cold shock DNA-binding domain-like
Resolution2.44

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60....
Predicted Secondary structure 














Query SS confidence 





























Query Sequence  GPMPGSRAGLRVVFTRPGVNLATVDIFYNG
Query Conservation                   
 
   
   
  
Alig confidence 




















.....



Template Conservation 

 

 
 










  .....


 
Template Sequence  EIVDISRGGMRVRLVDNGAIA. . . . . FIPA
Template Known Secondary structure  TTTTT

.....G
Template Predicted Secondary structure 





.....
Template SS confidence 





























   567..570.........580....... ..590.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions