Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADC8
Confidence2.88%DateThu Jan 5 11:20:37 GMT 2012
Rank68Aligned Residues25
% Identity16%Templatec3etcB_
PDB info PDB header:ligaseChain: B: PDB Molecule:amp-binding protein; PDBTitle: 2.1 a structure of acyl-adenylate synthetase from methanosarcina2 acetivorans containing a link between lys256 and cys298
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.. .......50
Predicted Secondary structure 






............
Query SS confidence 
















. . . . . . . . . . . .







Query Sequence  DNYVEHMKTNHPDKPYM. . . . . . . . . . . . SYEEFFRE
Query Conservation 
 

 
 
  

   

............
 


 
 
Alig confidence 
















............







Template Conservation     
   
   

  


  
       


 

   
Template Sequence  YDVVDVYARDSPEKLAMIWCDDYGNEKIFTFKDLKYY
Template Known Secondary structure  TSTTSSSS
Template Predicted Secondary structure 








Template SS confidence 




































   36...40.........50.........60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions