Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADC8
Confidence6.73%DateThu Jan 5 11:20:37 GMT 2012
Rank23Aligned Residues25
% Identity16%Templatec2gvmA_
PDB info PDB header:surface active proteinChain: A: PDB Molecule:hydrophobin-1; PDBTitle: crystal structure of hydrophobin hfbi with detergent
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.......
Predicted Secondary structure 

















Query SS confidence 






























Query Sequence  PDKPYMSYEEFFRERQNARYGGDGKGGMRCC
Query Conservation 
   


 


 
 
  


        


Alig confidence 
















......







Template Conservation 
   
     
   

 ...... 
  
 

Template Sequence  PSQNVYDGTDFRNVCAK. . . . . . TGAQPLCC
Template Known Secondary structure 
SS


ST......TT
Template Predicted Secondary structure 






......







Template SS confidence 






























   34.....40.........50 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions