Return to main results Retrieve Phyre Job Id

Job DescriptionP36553
Confidence14.93%DateThu Jan 5 11:53:14 GMT 2012
Rank19Aligned Residues17
% Identity71%Templatec2pbyB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:glutaminase; PDBTitle: probable glutaminase from geobacillus kaustophilus hta426
Resolution2.07 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   54.....60.........70.........80.........90.........100..
Predicted Secondary structure 



















Query SS confidence 
















































Query Sequence  VFEQAGVNFSHVHGEAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYV
Query Conservation 







 
 
 
   
              
 




 



 

 
Alig confidence 









................................






Template Conservation 
   

 


................................ 
 



Template Sequence  VFHKVGMEPA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KPLNPMI
Template Known Secondary structure  S





................................

S
SSS
Template Predicted Secondary structure 




................................



Template SS confidence 
















































   84.....90... ......100
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions