Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFU0
Confidence9.67%DateThu Jan 5 11:27:15 GMT 2012
Rank18Aligned Residues38
% Identity21%Templatec2hw2A_
PDB info PDB header:transferaseChain: A: PDB Molecule:rifampin adp-ribosyl transferase; PDBTitle: crystal structure of rifampin adp-ribosyl transferase in2 complex with rifampin
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.........80.........90...
Predicted Secondary structure 










































Query SS confidence 






























































Query Sequence  PGGPVDQAIAAIEFGNAGVLPGAGGEGVRASHAQTGVGNISDSNYRGGRGLDPEVIAEITHRY
Query Conservation 
 

                                                           
Alig confidence 










.........................


























Template Conservation 









 ......................... 

 




  
  



 

 

  
Template Sequence  PGNPTRSYRTR. . . . . . . . . . . . . . . . . . . . . . . . . EPVWIVGELTDWVGHPPEQLAAMRQGL
Template Known Secondary structure  SS
TT
S.........................S







Template Predicted Secondary structure 










.........................








Template SS confidence 






























































   93......100... ......110.........120.........130
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions