Return to main results Retrieve Phyre Job Id

Job DescriptionP27862
Confidence35.10%DateThu Jan 5 11:44:25 GMT 2012
Rank29Aligned Residues47
% Identity17%Templatec2p5xB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:n-acetylserotonin o-methyltransferase-like protein; PDBTitle: crystal structure of maf domain of human n-acetylserotonin o-2 methyltransferase-like protein
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50..... ....60.........70.........80
Predicted Secondary structure 






..........................

















Query SS confidence 

























. . . . . . . . . . . . . . . . . . . . . . . . . .
























Query Sequence  DGVEAAKAFVESVRAEHPDARHHCVA. . . . . . . . . . . . . . . . . . . . . . . . . . WVAGAPDDSQQLGFSDDGEPAGTAG
Query Conservation           
         
 
 
 
..........................
  
          





 



Alig confidence 















....





..........................
























Template Conservation      

   
  


 .... 
 
 
 
 
                    
 
 
  
    
  

   
    

Template Sequence  VDKQDAYRMLSRLSGR. . . . EHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAG
Template Known Secondary structure  SSTTS....
TTSS




TTSTTTTSGG
Template Predicted Secondary structure 




....





















Template SS confidence 












































































   102.......110....... ..120.........130.........140.........150.........160.........170....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions