Return to main results Retrieve Phyre Job Id

Job DescriptionP27862
Confidence7.56%DateThu Jan 5 11:44:25 GMT 2012
Rank67Aligned Residues27
% Identity26%Templatec1up6F_
PDB info PDB header:hydrolaseChain: F: PDB Molecule:6-phospho-beta-glucosidase; PDBTitle: structure of the 6-phospho-beta glucosidase from thermotoga2 maritima at 2.55 angstrom resolution in the tetragonal form3 with manganese, nad+ and glucose-6-phosphate
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100. ........110.........120
Predicted Secondary structure 
..................









Query SS confidence 







. . . . . . . . . . . . . . . . . .


















Query Sequence  EITAVVVR. . . . . . . . . . . . . . . . . . YYGGILLGTGGLVKAYGGG
Query Conservation 

 




..................







 






  
Alig confidence 







..................


















Template Conservation 
 

 
  


      
  

 
 
    

 
 

   




Template Sequence  KYVIFQFRPGGLKGRENDEGIPLKYGLIGQETTGVGGFSAALRAF
Template Known Secondary structure  S


TTTTT



SSST
Template Predicted Secondary structure 














Template SS confidence 












































   73......80.........90.........100.........110.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions