Return to main results Retrieve Phyre Job Id

Job DescriptionP27862
Confidence6.37%DateThu Jan 5 11:44:25 GMT 2012
Rank81Aligned Residues27
% Identity30%Templatec1s6yA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:6-phospho-beta-glucosidase; PDBTitle: 2.3a crystal structure of phospho-beta-glucosidase
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.. .......110.........120
Predicted Secondary structure 

..................








Query SS confidence 








. . . . . . . . . . . . . . . . . .

















Query Sequence  EITAVVVRY. . . . . . . . . . . . . . . . . . YGGILLGTGGLVKAYGGG
Query Conservation 

 





..................






 






  
Alig confidence 








..................

















Template Conservation 
 

 
  


      
  

 
 
    

 
 

   


 
Template Sequence  DFVTTQFRVGGLEARAKDERIPLKYGVIGQETNGPGGLFKGLRTI
Template Known Secondary structure  S


TTTGGGGT



SSST
Template Predicted Secondary structure 














Template SS confidence 












































   82.......90.........100.........110.........120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions