Return to main results Retrieve Phyre Job Id

Job DescriptionP00634
Confidence19.52%DateWed Jan 25 15:20:09 GMT 2012
Rank51Aligned Residues33
% Identity12%Templatec3bq9A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:predicted rossmann fold nucleotide-binding domain- PDBTitle: crystal structure of predicted nucleotide-binding protein from2 idiomarina baltica os145
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   181........190.........200.........210.........220.........
Predicted Secondary structure 


























Query SS confidence 
















































Query Sequence  LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGG
Query Conservation 
 

   
                        

 

     






Alig confidence 















................
















Template Conservation   





  


 
 
................


 

 


 





Template Sequence  WGGHSINEIEYKYTKD. . . . . . . . . . . . . . . . VGYHIGLRGLNICTGCG
Template Known Secondary structure 

SS

................TT


S
Template Predicted Secondary structure 






................





Template SS confidence 
















































   150.........160..... ....170.........180..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions