Return to main results Retrieve Phyre Job Id

Job DescriptionP25746
Confidence4.85%DateThu Jan 5 11:42:34 GMT 2012
Rank51Aligned Residues25
% Identity16%Templated1etea_
SCOP info4-helical cytokines 4-helical cytokines Short-chain cytokines
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190......... 200.........210...
Predicted Secondary structure  .......




Query SS confidence 










. . . . . . .













Query Sequence  LQLMFSRNRLT. . . . . . . TQAKQILAHLTPEL
Query Conservation 




 
  

.......  
  

  
    
Alig confidence 










.......













Template Conservation 
 
 

   



  



 
  

  
 


Template Sequence  WRLVLAQRWMERLKTVAGSKMQGLLERVNTEI
Template Known Secondary structure  TTS
Template Predicted Secondary structure 
Template SS confidence 































   48.50.........60.........70.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions