Return to main results Retrieve Phyre Job Id

Job DescriptionP25746
Confidence6.08%DateThu Jan 5 11:42:34 GMT 2012
Rank40Aligned Residues58
% Identity21%Templatec3imoC_
PDB info PDB header:unknown functionChain: C: PDB Molecule:integron cassette protein; PDBTitle: structure from the mobile metagenome of vibrio cholerae.2 integron cassette protein vch_cass14
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   107..110.........120.........130.........140.........150.........160.........170.........180......
Predicted Secondary structure 
















Query SS confidence 















































































Query Sequence  DTLGNRINGLQRQLEHFDLQSETLMSAMAAIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRATLLAGIRAAVLWHQVGG
Query Conservation    
  

     
  

   
  


 

 

 



 
 


 
 
    
     
 

















 

Alig confidence 











































.


........................







Template Conservation   

  
   

  

     
  




 
 

   
   
 
 .  
........................





 
Template Sequence  NILSQYISGVMARADHHAGNVEEIALALAGAILWRKDDTNIKVM. AKN. . . . . . . . . . . . . . . . . . . . . . . . VLWVTING
Template Known Secondary structure 
GGGB
SS
.


........................TT
Template Predicted Secondary structure 







.

........................

Template SS confidence 















































































   910.........20.........30.........40.........50.. ... ....60...
 
   187..
Predicted Secondary structure 
Query SS confidence 


Query Sequence  GRL
Query Conservation   

Alig confidence 


Template Conservation 


Template Sequence  ERY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   6970.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions