Return to main results Retrieve Phyre Job Id

Job DescriptionP0A717
Confidence44.43%DateThu Jan 5 11:04:30 GMT 2012
Rank150Aligned Residues56
% Identity9%Templatec2jfqA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:glutamate racemase; PDBTitle: crystal structure of staphylococcus aureus glutamate2 racemase in complex with d-glutamate
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   227..230.........240.........250.........260.........270.........280.........290.........300...
Predicted Secondary structure 























Query SS confidence 












































































Query Sequence  GTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRI
Query Conservation 


  

  

  

  
    

 

   
   
  
 
  

 



          
   
 

 


  
  
Alig confidence 






































.....................
















Template Conservation        
  
     
 






 
 
   
       .....................
 



    
      
Template Sequence  IVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGGK. . . . . . . . . . . . . . . . . . . . . KTVISSGLETAREVSAL
Template Known Secondary structure  GGGTT
S
SSSSGGGGTTT
.....................S
Template Predicted Secondary structure 










.....................

Template SS confidence 












































































   163......170.........180.........190.........200. ........210........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions