Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF36
Confidence86.40%DateThu Jan 5 11:25:03 GMT 2012
Rank5Aligned Residues42
% Identity38%Templatec2w6aB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:arf gtpase-activating protein git1; PDBTitle: x-ray structure of the dimeric git1 coiled-coil domain
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........60..
Predicted Secondary structure 
Query SS confidence 























































Query Sequence  VFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKE
Query Conservation   




 








 












  
 
 
       
 
  

  
  
Alig confidence 














..............


























Template Conservation 

 











..............
  

 


 

  
  

 

  

 
Template Sequence  ALATSEAKVQQLMKV. . . . . . . . . . . . . . NSSLSDELRKLQREIHKLQAENLQLRQ
Template Known Secondary structure  ..............T
Template Predicted Secondary structure  ..............

Template SS confidence 























































   441........450..... ....460.........470.........480..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions