Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS6
Confidence11.16%DateThu Jan 5 12:38:02 GMT 2012
Rank7Aligned Residues23
% Identity35%Templated1bjta_
SCOP infoType II DNA topoisomerase Type II DNA topoisomerase Type II DNA topoisomerase
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51...... ..60.........70...
Predicted Secondary structure  ...........


Query SS confidence 






. . . . . . . . . . .















Query Sequence  ELIDFST. . . . . . . . . . . DGLDANDKEIIRGMID
Query Conservation 
 



 ...........



 





  

 
Alig confidence 






...........















Template Conservation 


 

  
  





 













  
Template Sequence  ELILFSLADNIRSIPNVLDGFKPGQRKVLYGCFK
Template Known Secondary structure  S
BTTT


Template Predicted Secondary structure 









Template SS confidence 

































   679680.........690.........700.........710..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions