Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS6
Confidence9.97%DateThu Jan 5 12:38:02 GMT 2012
Rank13Aligned Residues23
% Identity30%Templatec3qx3B_
PDB info PDB header:isomerase/dna/isomerase inhibitorChain: B: PDB Molecule:dna topoisomerase 2-beta; PDBTitle: human topoisomerase iibeta in complex with dna and etoposide
Resolution2.16 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51...... ..60.........70...
Predicted Secondary structure  ...........


Query SS confidence 






. . . . . . . . . . .















Query Sequence  ELIDFST. . . . . . . . . . . DGLDANDKEIIRGMID
Query Conservation 
 



 ...........



 





  

 
Alig confidence 






...........















Template Conservation 


 

  

 





 













  
Template Sequence  ELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFK
Template Known Secondary structure  TS
BTTTS

Template Predicted Secondary structure 









Template SS confidence 

































   718.720.........730.........740.........750.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions