Return to main results Retrieve Phyre Job Id

Job DescriptionP75791
Confidence19.92%DateThu Jan 5 12:14:10 GMT 2012
Rank87Aligned Residues30
% Identity17%Templatec2kp6A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: solution nmr structure of protein cv0237 from2 chromobacterium violaceum. northeast structural genomics3 consortium (nesg) target cvt1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   104.....110.........120.........130.........140........
Predicted Secondary structure 
























Query SS confidence 












































Query Sequence  QSMLDYLDRNRFDEVYKGPGDNFFGTLSASRPEIYPIYWSQAQMQ
Query Conservation   

  
   
        
 
  
       








 


 
Alig confidence 
















.



..............








Template Conservation    
  

  
 
     .
 

..............



 

  
Template Sequence  AAIRAFIDSHPLPPRVP. LPEA. . . . . . . . . . . . . . PFWTPAQAA
Template Known Secondary structure  S


TTS
.STT
..............TTS
Template Predicted Secondary structure 







.



..............



Template SS confidence 












































   22.......30........ .40.. .......50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions