Return to main results Retrieve Phyre Job Id

Job DescriptionP76278
Confidence10.59%DateThu Jan 5 12:21:32 GMT 2012
Rank3Aligned Residues47
% Identity11%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.........230.........240.......
Predicted Secondary structure 








Query SS confidence 






























































Query Sequence  QALMRFSWCGHFAVIGVLASGVLNALLITGFPPTLTTYWGQLLLLKAILVMIMVVIALANRYV
Query Conservation    
 


  
   
  
  

   
        
  
 

 


 

 

  

 


 

  
Alig confidence 





















................
























Template Conservation    

 


 
 





 



................



     
          




Template Sequence  EVMKVLTIIATIFMPLTFIAGI. . . . . . . . . . . . . . . . YGYPVVLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  TTS................


TTTTS

Template Predicted Secondary structure  ................

Template SS confidence 






























































   289290.........300.........310 .........320.........330.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions