Return to main results Retrieve Phyre Job Id

Job DescriptionP61889
Confidence93.62%DateThu Jan 5 12:07:26 GMT 2012
Rank390Aligned Residues48
% Identity21%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60.........70........
Predicted Secondary structure 


























Query SS confidence 












































































Query Sequence  KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAG
Query Conservation 

 


  
 

   
  
        

 
 
          

                    
  








Alig confidence 





















...















..........................









Template Conservation 








 

  
   
   ...
  
    
   
   ..........................  
 


 
 
Template Sequence  RVLVTGATGLLGRAVHKEFQQN. . . NWHAVGCGVHHIIHDF. . . . . . . . . . . . . . . . . . . . . . . . . . QPHVIVHCAV
Template Known Secondary structure  TTTSTT...T


..........................

S


Template Predicted Secondary structure 




...


..........................





Template SS confidence 












































































   30.........40.........50. ........60....... ..70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions