Return to main results Retrieve Phyre Job Id

Job DescriptionP41065
Confidence72.40%DateThu Jan 5 12:01:22 GMT 2012
Rank6Aligned Residues30
% Identity20%Templated1tjla1
SCOP infoLong alpha-hairpin DnaK suppressor protein DksA, alpha-hairpin domain DnaK suppressor protein DksA, alpha-hairpin domain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.. .......20.........30
Predicted Secondary structure 


...........

Query SS confidence 











. . . . . . . . . . .

















Query Sequence  MSDEADEAYSVT. . . . . . . . . . . EQLTMTGINRIRQKINAH
Query Conservation 
 
  
 
    ...........
      
     
    
Alig confidence 











...........

















Template Conservation    
 

 

 
  
   
 
 


  

  

 

 

  
Template Sequence  FPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDE
Template Known Secondary structure 


GGGTT
Template Predicted Secondary structure 




Template SS confidence 








































   6970.........80.........90.........100.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions