Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE63
Confidence2.70%DateWed Jan 25 15:20:30 GMT 2012
Rank57Aligned Residues24
% Identity42%Templatec2i5hA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein af1531; PDBTitle: crystal structure of af1531 from archaeoglobus fulgidus,2 pfam duf655
Resolution1.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.... .....30
Predicted Secondary structure 



.......
Query SS confidence 

















. . . . . . .





Query Sequence  SDLPESVKHVLPSHAQDI. . . . . . . YKEAFN
Query Conservation   


  

  

 


 
.......
  


Alig confidence 

















.......





Template Conservation 



 


 

  

  

   
  

 


Template Sequence  EDLTPAAKTELPYVIEHIIKQDEKKYVDFFN
Template Known Secondary structure  GGS
TT
Template Predicted Secondary structure 


Template SS confidence 






























   90.........100.........110.........120
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions