Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE63
Confidence3.44%DateWed Jan 25 15:20:30 GMT 2012
Rank41Aligned Residues34
% Identity18%Templatec1zy7A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:rna-specific adenosine deaminase b1, isoform PDBTitle: crystal structure of the catalytic domain of an adenosine2 deaminase that acts on rna (hadar2) bound to inositol3 hexakisphosphate (ihp)
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70......
Predicted Secondary structure 




















Query SS confidence 











































Query Sequence  WDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS
Query Conservation     
            
  
  


 


  
 
   
 

 
 
Alig confidence 





..........



























Template Conservation 
 
 
 .......... 
  

 

  
         
 
  

Template Sequence  YHESKL. . . . . . . . . . AAKEYQAAKARLFTAFIKAGLGAWVEKP
Template Known Secondary structure  ..........T
TTS






Template Predicted Secondary structure  ..........









Template SS confidence 











































   658.660... ......670.........680.........690.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions