Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE63
Confidence2.40%DateWed Jan 25 15:20:30 GMT 2012
Rank73Aligned Residues31
% Identity19%Templatec1zv8I_
PDB info PDB header:viral proteinChain: I: PDB Molecule:e2 glycoprotein; PDBTitle: a structure-based mechanism of sars virus membrane fusion
Resolution1.94 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.........
Predicted Secondary structure 
















Query SS confidence 















































Query Sequence  QDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDD
Query Conservation 
 

  


 
   
            
  
  


 


  
 
   
Alig confidence 











.................


















Template Conservation 




 


 

.................
 
  

  
  

 


 
Template Sequence  QKQIANQFNKAI. . . . . . . . . . . . . . . . . SQIQESLTTTSTALGKLQD
Template Known Secondary structure  .................
Template Predicted Secondary structure  .................
Template SS confidence 















































   2.......10... ......20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions