Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE63
Confidence5.73%DateWed Jan 25 15:20:30 GMT 2012
Rank14Aligned Residues34
% Identity32%Templatec1fc9A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:photosystem ii d1 protease; PDBTitle: photosystem ii d1 c-terminal processing protease
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60......
Predicted Secondary structure 













Query SS confidence 












































Query Sequence  QDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAK
Query Conservation 
 

  


 
   
            
  
  


 


  
 
Alig confidence 
















...........
















Template Conservation     
   
      
  ...........    
 

      
  
Template Sequence  QLLFLEAWRAVDRAYVD. . . . . . . . . . . KSFNGQSWFKLRETYLK
Template Known Secondary structure 
S
...........TTGGG

Template Predicted Secondary structure 


...........






Template SS confidence 












































   82.......90........ .100.........110.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions