Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE63
Confidence17.54%DateWed Jan 25 15:20:30 GMT 2012
Rank7Aligned Residues32
% Identity31%Templatec1bpoA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:protein (clathrin); PDBTitle: clathrin heavy-chain terminal domain and linker
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50......
Predicted Secondary structure 















Query SS confidence 











































Query Sequence  VKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVA
Query Conservation 

  

 


 

  


 
   
            
  
  

Alig confidence 






.

















...........






Template Conservation   
 

 
.

 
    

 

  
 
...........  

  
Template Sequence  VRNNLAG. AEELFARKFNALFAQGNY. . . . . . . . . . . SEAAKVA
Template Known Secondary structure  TT
SS.
TT
...........
Template Predicted Secondary structure 




.


...........
Template SS confidence 











































   353...... 360.........370....... ..380....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions