Return to main results Retrieve Phyre Job Id

Job DescriptionP24173
Confidence61.63%DateThu Jan 5 11:40:47 GMT 2012
Rank87Aligned Residues67
% Identity13%Templatec3lp8A_
PDB info PDB header:ligaseChain: A: PDB Molecule:phosphoribosylamine-glycine ligase; PDBTitle: crystal structure of phosphoribosylamine-glycine ligase from2 ehrlichia chaffeensis
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 































Query SS confidence 















































































Query Sequence  MRVLIVKTSSMGDVLHTLPALTDAQQAIPGIKFDWVVEEGFAQIPSWHAAVERVIPVAIRRWRKAWFSAPIKAERKAFRE
Query Conservation 





    


 
   
 
  
    
   
  
       
    
 
  
                          
Alig confidence 








.....












..











....












.............








Template Conservation 






 
.....    
    
   ..     
      ....             .............  
   
  
Template Sequence  MNVLVIGSG. . . . . GREHSMLHHIRKS. . TLLNKLFIAPGR. . . . EGMSGLADIIDID. . . . . . . . . . . . . INSTIEVIQ
Template Known Secondary structure 
S.....TT
..TT

....GGGTTTS



.............TT
Template Predicted Secondary structure 



.....
..






....



.............


Template SS confidence 















































































   1........ 10.........20.. .......30.... .....40....... ..50......
 
   81........90.
Predicted Secondary structure 



Query SS confidence 










Query Sequence  ALQAENYDAVI
Query Conservation   
     
  
Alig confidence 










Template Conservation         
 
 
Template Sequence  VCKKEKIELVV
Template Known Secondary structure  TT

Template Predicted Secondary structure 


Template SS confidence 










   57..60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions