Return to main results Retrieve Phyre Job Id

Job DescriptionP46187
Confidence12.73%DateThu Jan 5 12:04:12 GMT 2012
Rank70Aligned Residues36
% Identity22%Templatec1pkvB_
PDB info PDB header:transferaseChain: B: PDB Molecule:riboflavin synthase alpha chain; PDBTitle: the n-terminal domain of riboflavin synthase in complex with2 riboflavin
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........60........
Predicted Secondary structure 





























Query SS confidence 





























































Query Sequence  TVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLVPGQKVELG
Query Conservation   

 
    
 

  
 


  
 
  


   
            
 
     


 
 
 
Alig confidence 

















..........................

















Template Conservation 

  
    
 
 




..........................
  
 
     
  



Template Sequence  TVTEINGNHVSFDLMKET. . . . . . . . . . . . . . . . . . . . . . . . . . LRITNLGDLKVGDWVNVE
Template Known Secondary structure  TT
..........................SSGGG

TT
Template Predicted Secondary structure 

..........................











Template SS confidence 





























































   50.........60....... ..70.........80.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions