Return to main results Retrieve Phyre Job Id

Job DescriptionP46187
Confidence22.26%DateThu Jan 5 12:04:12 GMT 2012
Rank37Aligned Residues38
% Identity24%Templatec1hzeB_
PDB info PDB header:transferaseChain: B: PDB Molecule:riboflavin synthase alpha chain; PDBTitle: solution structure of the n-terminal domain of riboflavin synthase2 from e. coli
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........60.........70
Predicted Secondary structure 






























Query SS confidence 































































Query Sequence  TVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLVPGQKVELGIA
Query Conservation   

 
    
 

  
 


  
 
  


   
            
 
     


 
 
 
 
Alig confidence 

















..........................



















Template Conservation 

  
    
 
 




..........................
  


     
  



  
Template Sequence  TVTEINGNHVSFDLMKET. . . . . . . . . . . . . . . . . . . . . . . . . . LRITNLGDLKVGDWVNVERA
Template Known Secondary structure  TT
..........................SSGGG

TTS
Template Predicted Secondary structure 

..........................













Template SS confidence 































































   50.........60....... ..70.........80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions