Return to main results Retrieve Phyre Job Id

Job DescriptionP39354
Confidence2.01%DateThu Jan 5 11:59:43 GMT 2012
Rank48Aligned Residues23
% Identity30%Templatec3rg0A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:calreticulin; PDBTitle: structural and functional relationships between the lectin and arm2 domains of calreticulin
Resolution2.57 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20......... 30......
Predicted Secondary structure 




.......






Query SS confidence 















. . . . . . .






Query Sequence  IYFSQYWAKGDFIAKR. . . . . . . APIGQWE
Query Conservation   


 


 

 

  .......
 




Alig confidence 















.......






Template Conservation 


 
 
        

  
   
  
 
 
Template Sequence  IYFKEQFLDGDAWTNRWVESKHKSDFGKFV
Template Known Secondary structure 


SGGGGGGT

SSSS


Template Predicted Secondary structure 




















Template SS confidence 





























   21........30.........40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions