Return to main results Retrieve Phyre Job Id

Job DescriptionQ46836
Confidence22.92%DateThu Jan 5 12:35:03 GMT 2012
Rank162Aligned Residues26
% Identity15%Templatec2vrwB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:proto-oncogene vav; PDBTitle: critical structural role for the ph and c1 domains of the2 vav1 exchange factor
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.........100
Predicted Secondary structure 


























Query SS confidence 










































Query Sequence  SLALPRSHCPHCQQTIRIRDNIPLFSWLMLKGRCRDCQAKISK
Query Conservation 

  


 
  
   
   




 
 
 





 
   
  
Alig confidence 














.................










Template Conservation      
  


 

  .................

  
      
Template Sequence  GTFYQGYRCYRCRAP. . . . . . . . . . . . . . . . . AHKECLGRVPP
Template Known Secondary structure  SSSS
TTT

.................
GGGGGGS

Template Predicted Secondary structure 









.................





Template SS confidence 










































   538.540.........550.. .......560...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions