Return to main results Retrieve Phyre Job Id

Job DescriptionQ46836
Confidence62.09%DateThu Jan 5 12:35:03 GMT 2012
Rank17Aligned Residues23
% Identity43%Templatec2jneA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:hypothetical protein yfgj; PDBTitle: nmr structure of e.coli yfgj modelled with two zn+2 bound.2 northeast structural genomics consortium target er317.
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90......
Predicted Secondary structure 
















Query SS confidence 































Query Sequence  HCPHCQQTIRIRDNIPLFSWLMLKGRCRDCQA
Query Conservation   
  
   
   




 
 
 





 
  
Alig confidence 











.........










Template Conservation   

 

  
   .........     
  
  
Template Sequence  HCPQCQHVLDQD. . . . . . . . . NGHARCRSCGE
Template Known Secondary structure  B
SSS
SB.........TTTTT

Template Predicted Secondary structure 







.........


Template SS confidence 































   4.....10..... ....20......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions