Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP56100
DateThu Jan 5 12:06:17 GMT 2012
Unique Job IDf7568aaf6bb7901a

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template d2e74b1
Top template information
Fold:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Confidence and coverage
Confidence: 11.5% Coverage: 27%
10 residues ( 27% of your sequence) have been modelled with 11.5% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.......
Sequence  MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI
Secondary structure 


SS confidence 




































Disorder  ??

























????
????
Disorder confidence 




































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 2e74 chain B domain 1

3D model

Region: 2 - 11
Aligned: 10
Modelled: 10
Confidence: 11.5%
Identity: 30%
Fold: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Phyre2

PDB 1q90 chain D

3D model

Region: 2 - 11
Aligned: 10
Modelled: 10
Confidence: 11.3%
Identity: 40%
Fold: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Phyre2

PDB 1vf5 chain B

3D model

Region: 2 - 11
Aligned: 10
Modelled: 10
Confidence: 7.2%
Identity: 30%
Fold: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Phyre2

PDB 2nr1 chain A

3D model

Region: 3 - 17
Aligned: 13
Modelled: 15
Confidence: 5.6%
Identity: 46%
PDB header:receptor
Chain: A: PDB Molecule:nr1 m2;
PDBTitle: transmembrane segment 2 of nmda receptor nr1, nmr, 102 structures

Phyre2

PDB 3mk7 chain B

3D model

Region: 4 - 31
Aligned: 28
Modelled: 28
Confidence: 5.5%
Identity: 21%
PDB header:oxidoreductase
Chain: B: PDB Molecule:cytochrome c oxidase, cbb3-type, subunit o;
PDBTitle: the structure of cbb3 cytochrome oxidase

Phyre2
1

d2e74b1
2

d1q90d_
3

d1vf5b_
4

c2nr1A_
5

c3mk7B_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1d2e74b1



11.5 30 Fold:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
2d1q90d_



11.3 40 Fold:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
3d1vf5b_



7.2 30 Fold:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family:a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
4c2nr1A_



5.6 46 PDB header:receptor
Chain: A: PDB Molecule:nr1 m2;
PDBTitle: transmembrane segment 2 of nmda receptor nr1, nmr, 102 structures
5c3mk7B_



5.5 21 PDB header:oxidoreductase
Chain: B: PDB Molecule:cytochrome c oxidase, cbb3-type, subunit o;
PDBTitle: the structure of cbb3 cytochrome oxidase

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0