Return to main results Retrieve Phyre Job Id

Job DescriptionP56100
Confidence5.09%DateThu Jan 5 12:06:17 GMT 2012
Rank6Aligned Residues21
% Identity24%Templatec2bo9B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:human latexin; PDBTitle: human carboxypeptidase a4 in complex with human latexin.
Resolution1.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30
Predicted Secondary structure 
Query SS confidence 





























Query Sequence  MWYFAWILGTLLACSFGVITALALEHVESG
Query Conservation 








 




 






 
  
  
Alig confidence 





.....




....









Template Conservation   
 

 .....




....


  


 
Template Sequence  VLHLAW. . . . . VACGY. . . . IIWQNSTEDT
Template Known Secondary structure  .........

TT
Template Predicted Secondary structure  .....

....





Template SS confidence 





























   136...140. ..... ...150......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions